HPA027428

RC3H1 antibody from Sigma-Aldrich
KIAA2025, RNF198, roquin, RP5-1198E17.5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027428
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027428, RRID:AB_10600324
Product name
Anti-RC3H1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027428
Antibody type
Polyclonal
Antigen
ring finger and CCCH-type zinc finger domains 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RTSKTIYQGAGPMQAMAPQGAPTKSINISDYSPYG
THGGWGASPYSPHQNIPSQGHFSERERISMSEVAS
HGKPLPSAEREQLRLELQQLNHQISQQTQ
Storage
-20C
Provider Type Product Number
- No reagents -