Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunoprecipitation [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003431-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003431-M01, RRID:AB_566198
- Product name
- SP110 monoclonal antibody (M01), clone 8C8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SP110.
- Antigen sequence
TPSDKKGKKRKRCIWSTPKRRHKKKSLPRGTASSR
HGIQKKLKRVDQVPQKKDDSTCNSTVETRAQKART
ECARKSRSEEIIDGTSEMNEGKRSQKTPSTPRRVT
QGAAS- Isotype
- IgG
- Antibody clone number
- 8C8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of SP110 expression in transfected 293T cell line by SP110 monoclonal antibody (M01), clone 8C8.Lane 1: SP110 transfected lysate(61.8 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged SP110 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of SP110 transfected lysate using anti-SP110 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with SP110 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to SP110 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol