H00064326-M01
antibody from Abnova Corporation
Targeting: COP1
CFAP78, FAP78, FLJ10416, RFWD2, RNF200
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00064326-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00064326-M01, RRID:AB_509157
- Product name
- RFWD2 monoclonal antibody (M01), clone 1E4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RFWD2.
- Antigen sequence
CLRSFKGHINEKNFVGLASNGDYIACGSENNSLYL
YYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVS
AVCWRALPDGESNVLIAANSQGTIKVLELV- Isotype
- IgG
- Antibody clone number
- 1E4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- RFWD2 monoclonal antibody (M01), clone 1E4. Western Blot analysis of RFWD2 expression in A-431.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged RFWD2 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to RFWD2 on NIH/3T3 cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol