HPA036737

antibody from Atlas Antibodies

Targeting: PSMD1 P112, Rpn2, S1

Antibody data

Submit

Validation data

Product number: HPA036737 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA036737, RRID:AB_2675279
Product name: Anti-PSMD1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: CAGTGNKEAINLLEPMTNDPVNYVRQGALIASALI MIQQTEITCPKVNQFRQLYSKVINDKHDDVMAKFG AILAQG
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

PSMD1 protein structure - HPA036737 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, kidney, liver and testis using Anti-PSMD1 antibody HPA036737 (A) shows similar protein distribution across tissues to independent antibody HPA036736 (B).
Antibody #2 product nr: HPA036736
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebellum shows strong cytoplasmic and nuclear positivity in Purkinje cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-PSMD1 antibody HPA036737.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-PSMD1 antibody HPA036737.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-PSMD1 antibody HPA036737.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-PSMD1 antibody HPA036737.
Sample type: HUMAN