HPA007409

FAM20B antibody from Sigma-Aldrich
GXK1, KIAA0475
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007409
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007409, RRID:AB_10601649
Product name
Anti-FAM20B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007409
Antibody type
Polyclonal
Antigen
family with sequence similarity 20, member B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DAVKKTSPYDSGPRLLDIIDTAVFDYLIGNADRHH
YESFQDDEGASMLILLDNAKSFGNPSLDERSILAP
LYQCCIIRVSTWNRLNYLKNGVLKSALKSAMAHDP
ISPVLSDPHLDAVDQRLLSVLATVKQCTDQFGMDT
VLVED
Storage
-20C
Provider Type Product Number
- No reagents -