HPA028357

antibody from Atlas Antibodies

Targeting: CEP350 CAP350, KIAA0480

Antibody data

Submit

Validation data

Product number: HPA028357 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA028357, RRID:AB_10599426
Product name: Anti-CEP350
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: QDWFDEDFGLSSSHKIQKNKAEETIVPLMAEPKRV TQQPCETLLAVPHTAEEVEILVHNAAEELWKWKEL GHDLHSISIPTKLLGCASKGLDIESTSKRVYK
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

CEP350 protein structure - HPA028357 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, colon, kidney and testis using Anti-CEP350 antibody HPA028357 (A) shows similar protein distribution across tissues to independent antibody HPA028355 (B).
Antibody #2 product nr: HPA028355
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-CEP350 antibody HPA028357.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-CEP350 antibody HPA028357.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-CEP350 antibody HPA028357.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-CEP350 antibody HPA028357.
Sample type: HUMAN