HPA028357

CEP350 antibody from Sigma-Aldrich
CAP350, KIAA0480
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028357
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA028357, RRID:AB_10599426
Product name
Anti-CEP350 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA028357
Antibody type
Polyclonal
Antigen
centrosomal protein 350 kDa recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QDWFDEDFGLSSSHKIQKNKAEETIVPLMAEPKRV
TQQPCETLLAVPHTAEEVEILVHNAAEELWKWKEL
GHDLHSISIPTKLLGCASKGLDIESTSKRVYK
Storage
-20C
Provider Type Product Number
- No reagents -