Explore
Validate
Learn
ImmunocytochemistryAntibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA029894 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA029894, RRID:AB_10601433
- Product name
- Anti-IER5
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
RRNLEQPPSGGEDDDAEEMETGNVANLISIFGSSF
SGLLRKSPGGGREEEEGEESGPEAAEPGQICCDKP
V- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references
Cdc25B is transcriptionally inhibited by IER5 through the NF-YB transcription factor in irradiation-treated HeLa cells
IER5 generates a novel hypo-phosphorylated active form of HSF1 and contributes to tumorigenesis
Cao R, Jones D, Pan L, Yang A, Wang S, Padi S, Shaun R, Aster J, Blacklow S
2024
2024
Cdc25B is transcriptionally inhibited by IER5 through the NF-YB transcription factor in irradiation-treated HeLa cells
Ding L, Zhao X, Xiong Q, Jiang X, Liu X, Ding K, Zhou P
Toxicology Research 2021;10(4):875-884
Toxicology Research 2021;10(4):875-884
IER5 generates a novel hypo-phosphorylated active form of HSF1 and contributes to tumorigenesis
Asano Y, Kawase T, Okabe A, Tsutsumi S, Ichikawa H, Tatebe S, Kitabayashi I, Tashiro F, Namiki H, Kondo T, Semba K, Aburatani H, Taya Y, Nakagama H, Ohki R
Scientific Reports 2016;6(1)
Scientific Reports 2016;6(1)
No comments: Submit comment
No validations: Submit validation data