AV34040

RGS16 antibody from Sigma-Aldrich
A28-RGS14, RGS-r
No application information provided.

Antibody data

Product number
AV34040
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV34040, RRID:AB_1856234
Product name
Anti-RGS16 antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV34040
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human RGS16 with an internal ID of P05120
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
LQTATATCFDAAQGKTRTLMEKDSYPRFLKSPAYR
DLAAQASAASATLSS
Storage
-20C
Provider Type Product Number
- No reagents -