Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183913 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Small Nuclear Ribonucleoprotein 70kDa (U1) (SNRNP70) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SNRP70 antibody: synthetic peptide directed towards the N terminal of human SNRP70
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
PHNDPNAQGDAFKTLFVARVNYDTTESKLRREFEV
YGPIK RIHMVYSKRS- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references G Run-mediated recognition of proteolipid protein and DM20 5' splice sites by U1 small nuclear RNA is regulated by context and proximity to the splice site.
Zfp206 regulates ES cell gene expression and differentiation.
Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
Wang E, Mueller WF, Hertel KJ, Cambi F
The Journal of biological chemistry 2011 Feb 11;286(6):4059-71
The Journal of biological chemistry 2011 Feb 11;286(6):4059-71
Zfp206 regulates ES cell gene expression and differentiation.
Zhang W, Walker E, Tamplin OJ, Rossant J, Stanford WL, Hughes TR
Nucleic acids research 2006;34(17):4780-90
Nucleic acids research 2006;34(17):4780-90
Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
Brandenberger R, Wei H, Zhang S, Lei S, Murage J, Fisk GJ, Li Y, Xu C, Fang R, Guegler K, Rao MS, Mandalam R, Lebkowski J, Stanton LW
Nature biotechnology 2004 Jun;22(6):707-16
Nature biotechnology 2004 Jun;22(6):707-16
No comments: Submit comment
No validations: Submit validation data