Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA028345 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-NPL
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
IRAEELLDGILDKIPTFQGLKFSDTDLLDFGQCVD
QNRQQQFAFLFGVDEQLLSALVMGATGAVGSTYNY
L- Isotype
- IgG
- Vial size
- 100μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Profiling of Atherosclerotic Lesions by Gene and Tissue Microarrays Reveals PCSK6 as a Novel Protease in Unstable Carotid Atherosclerosis
Perisic L, Hedin E, Razuvaev A, Lengquist M, Osterholm C, Folkersen L, Gillgren P, Paulsson-Berne G, Ponten F, Odeberg J, Hedin U
Arteriosclerosis, Thrombosis, and Vascular Biology 2013;33(10):2432-2443
Arteriosclerosis, Thrombosis, and Vascular Biology 2013;33(10):2432-2443
No comments: Submit comment
No validations: Submit validation data