Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004759-M03 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004759-M03, RRID:AB_581586
- Product name
- NEU2 monoclonal antibody (M03), clone 3B9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant NEU2.
- Antigen sequence
AYRKLHPIQRPIPSAFCFLSHDHGRTWARGHFVAQ
DTLECQVAEVETGEQRVVTLNARSHLRARVQAQST
NDGLDFQESQLVKKLVEPP- Isotype
- IgG
- Antibody clone number
- 3B9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Increased concentration of sialidases by HeLa cells might influence the cytotoxic ability of NK cells.
Macrophages discriminate glycosylation patterns of apoptotic cell-derived microparticles.
Lee WC, Lee WL, Shyong WY, Yang LW, Ko MC, Sheu BC, Hsieh SL, Wang PH
Taiwanese journal of obstetrics & gynecology 2012 Jun;51(2):192-8
Taiwanese journal of obstetrics & gynecology 2012 Jun;51(2):192-8
Macrophages discriminate glycosylation patterns of apoptotic cell-derived microparticles.
Bilyy RO, Shkandina T, Tomin A, Muñoz LE, Franz S, Antonyuk V, Kit YY, Zirngibl M, Fürnrohr BG, Janko C, Lauber K, Schiller M, Schett G, Stoika RS, Herrmann M
The Journal of biological chemistry 2012 Jan 2;287(1):496-503
The Journal of biological chemistry 2012 Jan 2;287(1):496-503
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- NEU2 monoclonal antibody (M03), clone 3B9. Western Blot analysis of NEU2 expression in human liver.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- NEU2 monoclonal antibody (M03), clone 3B9. Western Blot analysis of NEU2 expression in human fetal liver.