Explore
Validate
LearnHPA028523
antibody from Atlas Antibodies
Targeting: PRG4
bG174L6.2, CACP, FLJ32635, HAPO, JCAP, MSF, SZP
ImmunohistochemistryAntibody data
- Antibody Data
- Antigen structure
- References [5]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA028523 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA028523, RRID:AB_10669642
- Product name
- Anti-PRG4
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
IGPSQTHTIRIQYSPARLAYQDKGVLHNEVKVSIL
WRGLPNVVTSAISLPNIRKPDGYDYYAFSKDQYYN
IDVPSRTARAITTRSGQTLSKVWYNC- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references
GDF5+ chondroprogenitors derived from human pluripotent stem cells preferentially form permanent chondrocytes
Proteoglycan 4 Modulates Osteogenic Smooth Muscle Cell Differentiation during Vascular Remodeling and Intimal Calcification
Proteoglycan 4 is Increased in Human Calcified Aortic Valves and Enhances Valvular Interstitial Cell Calcification
Spatial and Single-Cell Transcriptional Profiling Identifies Functionally Distinct Human Dermal Fibroblast Subpopulations.
Genotype-Phenotype Associations of IL6 and PRG4 With Conjunctival Fibrosis After Glaucoma Surgery
Pothiawala A, Sahbazoglu B, Ang B, Matthias N, Pei G, Yan Q, Davis B, Huard J, Zhao Z, Nakayama N
Development 2022;149(11)
Development 2022;149(11)
Proteoglycan 4 Modulates Osteogenic Smooth Muscle Cell Differentiation during Vascular Remodeling and Intimal Calcification
Seime T, Akbulut A, Liljeqvist M, Siika A, Jin H, Winski G, van Gorp R, Karlöf E, Lengquist M, Buckler A, Kronqvist M, Waring O, Lindeman J, Biessen E, Maegdefessel L, Razuvaev A, Schurgers L, Hedin U, Matic L
Cells 2021;10(6):1276
Cells 2021;10(6):1276
Proteoglycan 4 is Increased in Human Calcified Aortic Valves and Enhances Valvular Interstitial Cell Calcification
Artiach G, Carracedo M, Seime T, Plunde O, Laguna-Fernandez A, Matic L, Franco-Cereceda A, Bäck M
Cells 2020;9(3):684
Cells 2020;9(3):684
Spatial and Single-Cell Transcriptional Profiling Identifies Functionally Distinct Human Dermal Fibroblast Subpopulations.
Philippeos C, Telerman SB, Oulès B, Pisco AO, Shaw TJ, Elgueta R, Lombardi G, Driskell RR, Soldin M, Lynch MD, Watt FM
The Journal of investigative dermatology 2018 Apr;138(4):811-825
The Journal of investigative dermatology 2018 Apr;138(4):811-825
Genotype-Phenotype Associations of IL6 and PRG4 With Conjunctival Fibrosis After Glaucoma Surgery
Yu-Wai-Man C, Tagalakis A, Meng J, Bouremel Y, Lee R, Virasami A, Hart S, Khaw P
JAMA Ophthalmology 2017;135(11):1147
JAMA Ophthalmology 2017;135(11):1147
No comments: Submit comment
No validations: Submit validation data