Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005997-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005997-M01, RRID:AB_464105
- Product name
- RGS2 monoclonal antibody (M01), clone 4C4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RGS2.
- Antigen sequence
EFWLACEDFKKTKSPQKLSSKARKIYTDFIEKEAP
KEINIDFQTKTLIAQNIQEATSGCFTTAQKRVYSL
MENNSYPRFLESEFYQDLCKKPQITTEPHAT- Isotype
- IgG
- Antibody clone number
- 4C4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Semi-quantitative measurement of specific proteins in human cumulus cells using reverse phase protein array.
Role of JAK2-STAT3 in TLR2-mediated tissue factor expression.
RGS2 is a negative regulator of STAT3-mediated Nox1 expression.
Chromatin modifications induced by PML-RARalpha repress critical targets in leukemogenesis as analyzed by ChIP-Chip.
Puard V, Tranchant T, Cadoret V, Gauthier C, Reiter E, Guerif F, Royere D
Reproductive biology and endocrinology : RB&E 2013 Oct 22;11:100
Reproductive biology and endocrinology : RB&E 2013 Oct 22;11:100
Role of JAK2-STAT3 in TLR2-mediated tissue factor expression.
Park DW, Lyu JH, Kim JS, Chin H, Bae YS, Baek SH
Journal of cellular biochemistry 2013 Jun;114(6):1315-21
Journal of cellular biochemistry 2013 Jun;114(6):1315-21
RGS2 is a negative regulator of STAT3-mediated Nox1 expression.
Lee HK, Park DW, Bae JH, Kim HJ, Shin DG, Park JS, Lee JG, Lee SJ, Bae YS, Baek SH
Cellular signalling 2012 Mar;24(3):803-9
Cellular signalling 2012 Mar;24(3):803-9
Chromatin modifications induced by PML-RARalpha repress critical targets in leukemogenesis as analyzed by ChIP-Chip.
Hoemme C, Peerzada A, Behre G, Wang Y, McClelland M, Nieselt K, Zschunke M, Disselhoff C, Agrawal S, Isken F, Tidow N, Berdel WE, Serve H, Müller-Tidow C
Blood 2008 Mar 1;111(5):2887-95
Blood 2008 Mar 1;111(5):2887-95
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- RGS2 monoclonal antibody (M01), clone 4C4 Western Blot analysis of RGS2 expression in MCF-7 ( Cat # L046V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged RGS2 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to RGS2 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
