H00010920-M04

COPS8 antibody from Abnova Corporation
COP9, CSN8, MGC1297, SGN8

Antibody data

Product number
H00010920-M04
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010920-M04, RRID:AB_1574071
Product name
COPS8 monoclonal antibody (M04), clone 2G8
Provider product page
Abnova Corporation - H00010920-M04
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant COPS8.
Antigen sequence
MPVAVMAESAFSFKKLLDQCENQELEAPGGIATPP
VYGQLLALYLLHNDMNNARYLWKRIPPAIKSANSE
LGGIWSVGQRIWQRDFPGIYTTINAHQWSETVQPI
MEALRDATRRRAFALVSQAYTSIIADDFAAFVGLP
VEEAVKGILEQGWQADSTTRMVLPRKPVAGALDVS
FNKFIPLSEPAPVPPIPNEQQLARLTDYVAFLEN
Isotype
IgG
Antibody clone number
2G8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -