Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00023418-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00023418-A01, RRID:AB_463370
- Product name
- CRB1 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant CRB1.
- Antigen sequence
FCNKNNTRCLSNSCQNNSTCKDFSKDNDCSCSDTA
NNLDKDCDNMKDPCFSNPCQGSATCVNTPGERSFL
CKCPPGYSGTICETTIGSCGKNSCQHGGICHQDPI
YPVC- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Overexpression of human CRB1 or related isoforms, CRB2 and CRB3, does not regulate the human presenilin complex in culture cells.
Pardossi-Piquard R, Chen F, Silva-Gagliardi NF, Szego M, McInnes R, McGlade CJ, St George-Hyslop P, Fraser PE
Biochemistry 2007 Dec 4;46(48):13704-10
Biochemistry 2007 Dec 4;46(48):13704-10
No comments: Submit comment
No validations: Submit validation data