HPA002476

ABCC4 antibody from Atlas Antibodies
EST170205, MOAT-B, MOATB, MRP4
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002476
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002476, RRID:AB_1844434
Product name
Anti-ABCC4
Provider product page
Atlas Antibodies - HPA002476
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
NFSVGQRQLVCLARAILRKNQILIIDEATANVDPR
TDELIQKKIREKFAHCTVLTIAHRLNTIIDSDKIM
VLDSGRLKEYDEPYVLLQNKESLFYKMVQQLGKAE
AAALTETAKQVYFKRNYPHIGHTDHMVTNTSNGQP
ST
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -