HPA002476

ABCC4 antibody from Sigma-Aldrich
EST170205, MOAT-B, MOATB, MRP4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002476
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002476, RRID:AB_1844434
Product name
Anti-ABCC4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002476
Antibody type
Polyclonal
Antigen
Multidrug resistance-associated protein 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NFSVGQRQLVCLARAILRKNQILIIDEATANVDPR
TDELIQKKIREKFAHCTVLTIAHRLNTIIDSDKIM
VLDSGRLKEYDEPYVLLQNKESLFYKMVQQLGKAE
AAALTETAKQVYFKRNYPHIGHTDHMVTNTSNGQP
ST
Storage
-20C
Provider Type Product Number
- No reagents -