H00163486-B01

DENND1B antibody from Abnova Corporation
C1orf218, FAM31B, FLJ20054, MGC27044

Antibody data

Product number
H00163486-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00163486-B01, RRID:AB_1204262
Product name
DENND1B MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00163486-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human DENND1B protein.
Antigen sequence
MAAAPREEKRWPQPVFSNPVVLWKFPEDFGDQEIL
QSVPKFCFPFDVERVSQNQVGQHFTFVLTDIESKQ
RFGFCRLTSGGTICLCILSYLPWFEVYYKLLNTLA
DYLAKELENDLNETLRSLYNHPVPKANTPVNLSVH
SYFIAPDVTGLPTIPESRNLTEYFVAVDVNNMLQL
YASMLHERRIVIISSKLSTLTACIHGSAALLYPMY
WQHIYIPVLPPHLLDYCCAPMPYLIGIHSSLIERV
KNKSLEDVVMLNVDTNTLESPFSDLNNLPSDVVSA
LKNKLKKQSTATGDGVARAFLRAQAALFGYYRDAL
RYKPGEPITFCEESFVKHRSSVMKQFLETAINLQL
FKQFIDGRLAKLNAGRGFSDVFEEEITSGGFCGGK
DKLQYDYPFSQ
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -