Antibody data

Product number
H00127124-M13
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00127124-M13, RRID:AB_1571561
Product name
ATP6V1G3 monoclonal antibody (M13), clone 3A5
Provider product page
Abnova Corporation - H00127124-M13
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ATP6V1G3.
Antigen sequence
EEAMVEIDQYRMQRDKEFRLKQSKIMGSQNNLSDE
IEEQTLGKIQELNGHYNKYMESVMNQLLSMVCDMK
PEIHVNYRATN
Isotype
IgG
Antibody clone number
3A5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -