Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405885 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Transmembrane Protein 9 (TMEM9) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TMEM9 antibody: synthetic peptide directed towards the C terminal of human TMEM9
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Zebrafish
- Host
- Rabbit
- Antigen sequence
DARSMAAAAASLGGPRANTVLERVEGAQQRWKLQV
QEQRK TVFDRHKMLS- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The LIFEdb database in 2006.
Mehrle A, Rosenfelder H, Schupp I, del Val C, Arlt D, Hahne F, Bechtel S, Simpson J, Hofmann O, Hide W, Glatting KH, Huber W, Pepperkok R, Poustka A, Wiemann S
Nucleic acids research 2006 Jan 1;34(Database issue):D415-8
Nucleic acids research 2006 Jan 1;34(Database issue):D415-8
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting