HPA000289

UBA1 antibody from Atlas Antibodies
A1S9T, CFAP124, GXP1, POC20, UBE1, UBE1X
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA000289
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000289, RRID:AB_611865
Product name
Anti-UBA1
Provider product page
Atlas Antibodies - HPA000289
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LAAPRHQYYNQEWTLWDRFEVQGLQPNGEEMTLKQ
FLDYFKTEHKLEITMLSQGVSMLYSFFMPAAKLKE
RLDQPMTEIVSRVSKRKLGRHVRALVLELCCNDES
GEDVEVP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -