HPA000289

UBA1 antibody from Sigma-Aldrich
A1S9T, CFAP124, GXP1, POC20, UBE1, UBE1X
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000289
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000289, RRID:AB_1080443
Product name
Anti-UBE1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000289
Antibody type
Polyclonal
Antigen
Ubiquitin-like modifier-activating enzyme 1 (ubiquitin-activating enzyme E1) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LAAPRHQYYNQEWTLWDRFEVQGLQPNGEEMTLKQ
FLDYFKTEHKLEITMLSQGVSMLYSFFMPAAKLKE
RLDQPMTEIVSRVSKRKLGRHVRALVLELCCNDES
GEDVEVP
Storage
-20C
Provider Type Product Number
- No reagents -