Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008864-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008864-M01, RRID:AB_530169
- Product name
- PER2 monoclonal antibody (M01), clone 5C10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PER2.
- Antigen sequence
MNGYAEFPPSPSNPTKEPVEPQPSQVPLQEDVDMS
SGSSGHETNENCSTGRDSQGSDCDDSGKELGMLVE
PPDARQSPDTFSLMMAKSEHNPSTSGCSSD- Isotype
- IgG
- Antibody clone number
- 5C10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Prognostic relevance of Period1 (Per1) and Period2 (Per2) expression in human gastric cancer.
Aberrant expression of Per1, Per2 and Per3 and their prognostic relevance in non-small cell lung cancer.
Zhao H, Zeng ZL, Yang J, Jin Y, Qiu MZ, Hu XY, Han J, Liu KY, Liao JW, Xu RH, Zou QF
International journal of clinical and experimental pathology 2014;7(2):619-30
International journal of clinical and experimental pathology 2014;7(2):619-30
Aberrant expression of Per1, Per2 and Per3 and their prognostic relevance in non-small cell lung cancer.
Liu B, Xu K, Jiang Y, Li X
International journal of clinical and experimental pathology 2014;7(11):7863-71
International journal of clinical and experimental pathology 2014;7(11):7863-71
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged PER2 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to PER2 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to PER2 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 1 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol