Antibody data
- Antibody Data
- Antigen structure
- References [7]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00117581-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00117581-M01, RRID:AB_426125
- Product name
- TWIST2 monoclonal antibody (M01), clone 3C8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant TWIST2.
- Antigen sequence
MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRY
SKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRIL
ANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQ
TLKLAARYIDFLYQVLQSDEMDNKMTSCSYVAHER
LSYAFSVWRMEGSWSMSASH- Isotype
- IgG
- Antibody clone number
- 3C8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Epithelial-mesenchymal transition-like events in vulvar cancer and its relation with HPV.
Twist2 is a valuable prognostic biomarker for colorectal cancer.
Significance of heterogeneous Twist2 expression in human breast cancers.
Discordant gene expression signatures and related phenotypic differences in lamin A- and A/C-related Hutchinson-Gilford progeria syndrome (HGPS).
Twist2 contributes to breast cancer progression by promoting an epithelial-mesenchymal transition and cancer stem-like cell self-renewal.
Interleukin 17 acts in synergy with B cell-activating factor to influence B cell biology and the pathophysiology of systemic lupus erythematosus.
Molecular mechanism of transforming growth factor-beta-mediated inhibition of growth arrest and differentiation in a myoblast cell line.
Rodrigues IS, Lavorato-Rocha AM, de M Maia B, Stiepcich MM, de Carvalho FM, Baiocchi G, Soares FA, Rocha RM
British journal of cancer 2013 Jul 9;109(1):184-94
British journal of cancer 2013 Jul 9;109(1):184-94
Twist2 is a valuable prognostic biomarker for colorectal cancer.
Yu H, Jin GZ, Liu K, Dong H, Yu H, Duan JC, Li Z, Dong W, Cong WM, Yang JH
World journal of gastroenterology 2013 Apr 21;19(15):2404-11
World journal of gastroenterology 2013 Apr 21;19(15):2404-11
Significance of heterogeneous Twist2 expression in human breast cancers.
Mao Y, Zhang N, Xu J, Ding Z, Zong R, Liu Z
PloS one 2012;7(10):e48178
PloS one 2012;7(10):e48178
Discordant gene expression signatures and related phenotypic differences in lamin A- and A/C-related Hutchinson-Gilford progeria syndrome (HGPS).
Plasilova M, Chattopadhyay C, Ghosh A, Wenzel F, Demougin P, Noppen C, Schaub N, Szinnai G, Terracciano L, Heinimann K
PloS one 2011;6(6):e21433
PloS one 2011;6(6):e21433
Twist2 contributes to breast cancer progression by promoting an epithelial-mesenchymal transition and cancer stem-like cell self-renewal.
Fang X, Cai Y, Liu J, Wang Z, Wu Q, Zhang Z, Yang CJ, Yuan L, Ouyang G
Oncogene 2011 Nov 24;30(47):4707-20
Oncogene 2011 Nov 24;30(47):4707-20
Interleukin 17 acts in synergy with B cell-activating factor to influence B cell biology and the pathophysiology of systemic lupus erythematosus.
Doreau A, Belot A, Bastid J, Riche B, Trescol-Biemont MC, Ranchin B, Fabien N, Cochat P, Pouteil-Noble C, Trolliet P, Durieu I, Tebib J, Kassai B, Ansieau S, Puisieux A, Eliaou JF, Bonnefoy-Bérard N
Nature immunology 2009 Jul;10(7):778-85
Nature immunology 2009 Jul;10(7):778-85
Molecular mechanism of transforming growth factor-beta-mediated inhibition of growth arrest and differentiation in a myoblast cell line.
Murakami M, Ohkuma M, Nakamura M
Development, growth & differentiation 2008 Feb;50(2):121-30
Development, growth & differentiation 2008 Feb;50(2):121-30
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of TWIST2 expression in transfected 293T cell line by TWIST2 monoclonal antibody (M01), clone 3C8.Lane 1: TWIST2 transfected lysate(18.1 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged TWIST2 is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to TWIST2 on formalin-fixed paraffin-embedded human adrenal gland. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol