H00117581-M20A

TWIST2 antibody from Abnova Corporation
bHLHa39, Dermo-1, DERMO1

Antibody data

Product number
H00117581-M20A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00117581-M20A, RRID:AB_1137516
Product name
TWIST2 monoclonal antibody (M20A), clone 3B2
Provider product page
Abnova Corporation - H00117581-M20A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant TWIST2.
Antigen sequence
GSPSAQSFEELQSQRILANVRERQRTQSLNEAFAA
LRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQS
DEMDNKMTSCSYVAHER
Isotype
IgM
Antibody clone number
3B2
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -