HPA027601

PHLDA3 antibody from Sigma-Aldrich
TIH1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027601
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027601, RRID:AB_10601389
Product name
Anti-PHLDA3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027601
Antibody type
Polyclonal
Antigen
pleckstrin homology-like domain, family A, member 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LWKRKRCVLTERGLQLFEAKGTGGRPKELSFARIK
AVECVESTGRHIYFTLVTEGGGEIDFRCPLEDPGW
NAQITLGLVKFKNQQAIQTVR
Storage
-20C
Provider Type Product Number
- No reagents -