Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA030571 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA030571, RRID:AB_10602322
- Product name
- Anti-GPC1
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
DAEWRNLLDSMVLITDKFWGTSGVESVIGSVHTWL
AEAINALQDNRDTLTAKVIQGCGNPKVNPQGPGPE
EKRR- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Advanced fabrication of biosensor on detection of Glypican-1 using S-Acetylmercaptosuccinic anhydride (SAMSA) modification of antibody
Stromal heparan sulfate differentiates neuroblasts to suppress neuroblastoma growth
Dai Y, Abbasi K, DePietro M, Butler S, Liu C
Scientific Reports 2018;8(1)
Scientific Reports 2018;8(1)
Stromal heparan sulfate differentiates neuroblasts to suppress neuroblastoma growth
Knelson E, Gaviglio A, Nee J, Starr M, Nixon A, Marcus S, Blobe G
Journal of Clinical Investigation 2014;124(7):3016-3031
Journal of Clinical Investigation 2014;124(7):3016-3031
No comments: Submit comment
No validations: Submit validation data