Antibody data

Product number
H00057140-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00057140-B01, RRID:AB_1138896
Product name
RNPEPL1 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00057140-B01
Antibody type
Polyclonal
Antigen
RNPEPL1 (NP_060696, 1 a.a. ~ 494 a.a) full-length human protein.
Reactivity
Human
Host
Mouse
Antigen sequence
MSATRSAYMEEEGVFHFHMEHPVPAYLVALVAGDL
KPADIGPRSRVWAEPCLLPTATSKLSGAVEQWLSA
AERLYGPYMWGRYDIVFLPPSFPIVAMENPCLTFI
ISSILESDEFLVIDVIHEVAHSWFGNAVTNATWEE
MWLSEGLATYAQRRITTETYGAAFTCLETAFRLDA
LHRQMKLLGEDSPVSKLQVKLEPGVNPSHLMNLFT
YEKGYCFVYYLSQLCGDPQRFDDFLRAYVEKYKFT
SVVAQDLLDSFLSFFPELKEQSVDCRAGLEFERWL
NATGPPLAEPDLSQGSSLTRPVEALFQLWTAEPLD
QAAASASAIDISKWRTFQTALFLDRLLDGSPLPQE
VVMSLSKCYSSLLDSMNAEIRIRWLQIVVRNDYYP
DLHRVRRFLESQMSRMYTIPLYEDLCTGALKSFAL
EVFYQTQGRLHPNLRRAIQQILSQGLGSSTEPASE
PSTELGKAEADTDSDAQALLLGDEAPSSAISLRDV
NVSA
Vial size
50 uL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -