ABIN405855

MMP23B antibody from antibodies-online
MIFR, MIFR-1, MMP22

Antibody data

Product number
ABIN405855
Provider
antibodies-online
Product name
anti-Matrix Metallopeptidase 23B (MMP23B) (Middle Region) antibody
Provider product page
antibodies-online - ABIN405855
Antibody type
Polyclonal
Antigen
The immunogen for anti-MMP23B antibody: synthetic peptide directed towards the middle region of human MMP23B
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine, Chicken/Avian
Host
Rabbit
Antigen sequence
QKILHKKGKVYWYKDQEPLEFSYPGYLALGEAHLS
IIANA VNEGTYTCVV
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -