Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310852 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Matrix Metallopeptidase 23B (MMP23B) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-MMP23B antibody: synthetic peptide directed towards the N terminal of human MMP23B
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine
- Host
- Rabbit
- Antigen sequence
ILSFPRNLLSPRETRRALAAAFRMWSDVSPFSFRE
VAPEQ PSDLRIGFYP- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Delineation of mechanisms and regions of dosage imbalance in complex rearrangements of 1p36 leads to a putative gene for regulation of cranial suture closure.
Gajecka M, Yu W, Ballif BC, Glotzbach CD, Bailey KA, Shaw CA, Kashork CD, Heilstedt HA, Ansel DA, Theisen A, Rice R, Rice DP, Shaffer LG
European journal of human genetics : EJHG 2005 Feb;13(2):139-49
European journal of human genetics : EJHG 2005 Feb;13(2):139-49
No comments: Submit comment
No validations: Submit validation data