HPA027715

RABIF antibody from Sigma-Aldrich
mss4, RASGRF3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027715
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027715, RRID:AB_10602151
Product name
Anti-RABIF antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027715
Antibody type
Polyclonal
Antigen
RAB interacting factor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MEPAEQPSELVSAEGRNRKAVLCQRCGSRVLQPGT
ALFSRRQLFLPSMRKKPALSDGSNPD
Storage
-20C
Provider Type Product Number
- No reagents -