HPA035371

antibody from Atlas Antibodies

Targeting: AGXT AGT, AGT1, AGXT1, PH1, SPAT, SPT

Antibody data

Submit

Validation data

Product number: HPA035371 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA035371, RRID:AB_2674593
Product name: Anti-AGXT
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: QLFVKDPALRLPTVTTVAVPAGYDWRDIVSYVIDH FDIEIMGGLGPSTGKVLRIGLLGCNATRENVDRVT EALRAALQHCPKKKL
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

AGXT protein structure - HPA035371 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human liver and pancreas tissues using HPA035371 antibody. Corresponding AGXT RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human endometrium, liver, pancreas and tonsil using Anti-AGXT antibody HPA035371 (A) shows similar protein distribution across tissues to independent antibody HPA035370 (B).
Antibody #2 product nr: HPA035370
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows strong granular positivity in cytoplasm in hepatocytes.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human endometrium shows no positivity in glandular cells as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human tonsil shows no positivity in non-germinal center cells as expected.
Sample type: HUMAN