HPA027097

MTERF4 antibody from MilliporeSigma / Merck KGaA
MGC61716, MTERFD2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027097
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA027097, RRID:AB_10603879
Product name
Anti-MTERFD2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA027097
Antibody type
Polyclonal
Antigen
MTERF domain containing 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ARQTPHLGEQRRTTASLLRKLTTASNGGVIEELSC
VRSNNYVQEPECRRNLVQCLLEKQGTPVVQGSLEL
ERVMSSLLDMGFSNAHINELLSVRRGASLQQLLDI
ISEFILLGLNPEPVCVVLKKSPQLL
Storage
-20C
Provider Type Product Number
- No reagents -