HPA028490

ZC3H11A antibody from MilliporeSigma / Merck KGaA
KIAA0663, ZC3HDC11A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028490
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA028490, RRID:AB_10601447
Product name
Anti-ZC3H11A antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA028490
Antibody type
Polyclonal
Antigen
zinc finger CCCH-type containing 11A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HPPVVINAADDDEDDDDQFSEEGDETKTPTLQPTP
EVHNGLRVTSVRKPAVNIKQGECLNFGIKTLEEIK
SKKMKEKSKKQGEGSSGVSSLLLH
Storage
-20C
Provider Type Product Number
- No reagents -