Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003814-M05 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003814-M05, RRID:AB_581710
- Product name
- KISS1 monoclonal antibody (M05), clone 1F7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant KISS1.
- Antigen sequence
PGEQSLPCTERKPAATARLSRRGTSLSPPPESSGS
PQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWN
SFGLRFGKREAAPGNHGRSAGRGWGAGAGQ- Isotype
- IgG
- Antibody clone number
- 1F7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references KiSS-1 expression in oral squamous cell carcinoma and its prognostic significance.
Menstrual cyclic change of metastin/GPR54 in endometrium.
GPR54 is a target for suppression of metastasis in endometrial cancer.
Expression of the metastasis suppressor gene KISS1 in uveal melanoma.
Shin WJ, Cho YA, Kang KR, Kim JH, Hong SD, Lee JI, Hong SP, Yoon HJ
APMIS : acta pathologica, microbiologica, et immunologica Scandinavica 2016 Apr;124(4):291-8
APMIS : acta pathologica, microbiologica, et immunologica Scandinavica 2016 Apr;124(4):291-8
Menstrual cyclic change of metastin/GPR54 in endometrium.
Baba T, Kang HS, Hosoe Y, Kharma B, Abiko K, Matsumura N, Hamanishi J, Yamaguchi K, Yoshioka Y, Koshiyama M, Mandai M, Murphy SK, Konishi I
Medical molecular morphology 2015 Jun;48(2):76-84
Medical molecular morphology 2015 Jun;48(2):76-84
GPR54 is a target for suppression of metastasis in endometrial cancer.
Kang HS, Baba T, Mandai M, Matsumura N, Hamanishi J, Kharma B, Kondoh E, Yoshioka Y, Oishi S, Fujii N, Murphy SK, Konishi I
Molecular cancer therapeutics 2011 Apr;10(4):580-90
Molecular cancer therapeutics 2011 Apr;10(4):580-90
Expression of the metastasis suppressor gene KISS1 in uveal melanoma.
Martins CM, Fernandes BF, Antecka E, Di Cesare S, Mansure JJ, Marshall JC, Burnier MN Jr
Eye (London, England) 2008 May;22(5):707-11
Eye (London, England) 2008 May;22(5):707-11
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of KISS1 expression in transfected 293T cell line by KISS1 monoclonal antibody (M05), clone 1F7.Lane 1: KISS1 transfected lysate(14.7 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged KISS1 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to KISS1 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
