Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00022874-M03 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00022874-M03, RRID:AB_1578885
- Product name
- PLEKHA6 monoclonal antibody (M03), clone 1A4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full-length recombinant PLEKHA6.
- Antigen sequence
MHPRWAARLPLFISLLERADSVTAAYAKQH- Isotype
- IgG
- Antibody clone number
- 1A4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged PLEKHA6 is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol