Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN504528 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Bone Morphogenetic Protein 6 (BMP6) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-BMP6 antibody: synthetic peptide directed towards the middle region of human BMP6
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Porcine
- Host
- Rabbit
- Antigen sequence
MVAFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQD
VARVS SASDYNSSEL- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Identification of genetic polymorphisms associated with risk for pulmonary hypertension in sickle cell disease.
Ashley-Koch AE, Elliott L, Kail ME, De Castro LM, Jonassaint J, Jackson TL, Price J, Ataga KI, Levesque MC, Weinberg JB, Orringer EP, Collins A, Vance JM, Telen MJ
Blood 2008 Jun 15;111(12):5721-6
Blood 2008 Jun 15;111(12):5721-6
No comments: Submit comment
No validations: Submit validation data