HPA058085

RBBP5 antibody from Atlas Antibodies
RBQ3, SWD1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA058085
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA058085, RRID:AB_2683600
Product name
Anti-RBBP5
Provider product page
Atlas Antibodies - HPA058085
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
HGTRGELLLDVAWHPVRPIIASISSGVVSIWAQNQ
VENWSAFAPDFKELDENVEYEERESEFDIEDEDKS
EPEQTGADAAEDEEVDVTSVDPIAAFCSSDEELED
SKALLYLPIA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -