Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010494-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010494-M01, RRID:AB_464017
- Product name
- STK25 monoclonal antibody (M01), clone 1G6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant STK25.
- Antigen sequence
FPPTIRPSPHSKLHKGTALHSSQKPAEPVKRQPRS
QCLSTLVRPVFGELKEKHKQSGGSVGALEELENAF
SLAEESCPGISDKLMVHLVERVQRFSHNRNHLTST
R- Isotype
- IgG
- Antibody clone number
- 1G6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Differential expression of MST4, STK25 and PDCD10 between benign prostatic hyperplasia and prostate cancer.
Adaptor protein cerebral cavernous malformation 3 (CCM3) mediates phosphorylation of the cytoskeletal proteins ezrin/radixin/moesin by mammalian Ste20-4 to protect cells from oxidative stress.
CCM3/PDCD10 stabilizes GCKIII proteins to promote Golgi assembly and cell orientation.
Zhang H, Ma X, Peng S, Nan X, Zhao H
International journal of clinical and experimental pathology 2014;7(11):8105-11
International journal of clinical and experimental pathology 2014;7(11):8105-11
Adaptor protein cerebral cavernous malformation 3 (CCM3) mediates phosphorylation of the cytoskeletal proteins ezrin/radixin/moesin by mammalian Ste20-4 to protect cells from oxidative stress.
Fidalgo M, Guerrero A, Fraile M, Iglesias C, Pombo CM, Zalvide J
The Journal of biological chemistry 2012 Mar 30;287(14):11556-65
The Journal of biological chemistry 2012 Mar 30;287(14):11556-65
CCM3/PDCD10 stabilizes GCKIII proteins to promote Golgi assembly and cell orientation.
Fidalgo M, Fraile M, Pires A, Force T, Pombo C, Zalvide J
Journal of cell science 2010 Apr 15;123(Pt 8):1274-84
Journal of cell science 2010 Apr 15;123(Pt 8):1274-84
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of STK25 expression in transfected 293T cell line by STK25 monoclonal antibody (M01), clone 1G6.Lane 1: STK25 transfected lysate (Predicted MW: 48.1 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- STK25 monoclonal antibody (M01), clone 1G6. Western Blot analysis of STK25 expression in HepG2.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged STK25 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol