Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00084289-B01P - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00084289-B01P, RRID:AB_1678352
- Product name
- ING5 purified MaxPab mouse polyclonal antibody (B01P)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human ING5 protein.
- Antigen sequence
MATAMYLEHYLDSIENLPCELQRNFQLMRELDQRT
EDKKAEIDILAAEYISTVKTLSPDQRVERLQKIQN
AYSKCKEYSDDKVQLAMQTYEMVDKHIRRLDADLA
RFEADLKDKMEGSDFESSGGRGLKKGRGQKEKRGS
RGRGRRTSEEDTPKKKKHKGGSEFTDTILSVHPSD
VLDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCPIE
WFHFACVDLTTKPKGKWFCPRCVQEKRKKK- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Posterior association networks and functional modules inferred from rich phenotypes of gene perturbations.
Diverse epigenetic strategies interact to control epidermal differentiation.
Moz and retinoic acid coordinately regulate H3K9 acetylation, Hox gene expression, and segment identity.
Wang X, Castro MA, Mulder KW, Markowetz F
PLoS computational biology 2012;8(6):e1002566
PLoS computational biology 2012;8(6):e1002566
Diverse epigenetic strategies interact to control epidermal differentiation.
Mulder KW, Wang X, Escriu C, Ito Y, Schwarz RF, Gillis J, Sirokmány G, Donati G, Uribe-Lewis S, Pavlidis P, Murrell A, Markowetz F, Watt FM
Nature cell biology 2012 Jun 24;14(7):753-63
Nature cell biology 2012 Jun 24;14(7):753-63
Moz and retinoic acid coordinately regulate H3K9 acetylation, Hox gene expression, and segment identity.
Voss AK, Collin C, Dixon MP, Thomas T
Developmental cell 2009 Nov;17(5):674-86
Developmental cell 2009 Nov;17(5):674-86
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of ING5 expression in transfected 293T cell line (H00084289-T01) by ING5 MaxPab polyclonal antibody.Lane 1: ING5 transfected lysate(26.4 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ING5 MaxPab polyclonal antibody. Western Blot analysis of ING5 expression in Jurkat.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of purified MaxPab antibody to ING5 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol