Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00115019-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00115019-A01, RRID:AB_607039
- Product name
- SLC26A9 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant SLC26A9.
- Antigen sequence
QTQFRNGYALAQVMDTDIYVNPKTYNRAQDIQGIK
IITYCSPLYFANSEIFRQKVIAKTGMDPQKVLLAK
QKYLKKQEKRRMRPTQQRRSLFMKTKTVSLQELQQ
DFENA- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Nedd4-2 does not regulate wt-CFTR in human airway epithelial cells.
Koeppen K, Chapline C, Sato JD, Stanton BA
American journal of physiology. Lung cellular and molecular physiology 2012 Oct 15;303(8):L720-7
American journal of physiology. Lung cellular and molecular physiology 2012 Oct 15;303(8):L720-7
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- SLC26A9 polyclonal antibody (A01), Lot # 060717JCS1. Western Blot analysis of SLC26A9 expression in Daoy.