Antibody data

Product number
H00115019-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00115019-M02, RRID:AB_1137456
Product name
SLC26A9 monoclonal antibody (M02), clone 4E9
Provider product page
Abnova Corporation - H00115019-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant SLC26A9.
Antigen sequence
QTQFRNGYALAQVMDTDIYVNPKTYNRAQDIQGIK
IITYCSPLYFANSEIFRQKVIAKTGMDPQKVLLAK
QKYLKKQEKRRMRPTQQRRSLFMKTKTVSLQELQQ
DFENA
Isotype
IgG
Antibody clone number
4E9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -