ABIN504559
antibody from antibodies-online
Targeting: SIRPA
BIT, CD172a, MFR, MYD-1, P84, PTPNS1, SHPS-1, SHPS1, SIRP, SIRP-ALPHA-1, SIRPalpha, SIRPalpha2
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN504559 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Signal-Regulatory Protein alpha (SIRPA) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SIRPA antibody: synthetic peptide directed towards the C terminal of human SIRPA
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Porcine
- Host
- Rabbit
- Antigen sequence
QTSPQPASEDTLTYADLDMVHLNRTPKQPAPKPEP
SFSEY ASVQVPRK- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references LPS-induced down-regulation of signal regulatory protein {alpha} contributes to innate immune activation in macrophages.
Kong XN, Yan HX, Chen L, Dong LW, Yang W, Liu Q, Yu LX, Huang DD, Liu SQ, Liu H, Wu MC, Wang HY
The Journal of experimental medicine 2007 Oct 29;204(11):2719-31
The Journal of experimental medicine 2007 Oct 29;204(11):2719-31
No comments: Submit comment
No validations: Submit validation data