Antibody data

Product number
H00001939-M05
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001939-M05, RRID:AB_1576801
Product name
EIF2D monoclonal antibody (M05), clone 2D10
Provider product page
Abnova Corporation - H00001939-M05
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant EIF2D.
Antigen sequence
KGRICPIDITLAQRASNKKVTVVRNLEAYGLDPYS
VAAILQQRCQASTTVNPAPGAKDSLQVQIQGNQVH
HLGWLLLEEYQLPRKHIQGLEKALKPGKKK
Isotype
IgG
Antibody clone number
2D10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -