Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [3]
- ELISA [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00050604-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00050604-M01, RRID:AB_509367
- Product name
- IL20 monoclonal antibody (M01), clone 2H8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant IL20.
- Antigen sequence
RTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTP
DHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGE
EAMKKYSQILSHFEKLEPQAAVVKALGELDILLQW
MEETE- Isotype
- IgG
- Antibody clone number
- 2H8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- IL20 monoclonal antibody (M01), clone 2H8 Western Blot analysis of IL20 expression in K-562 ( Cat # L009V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- IL20 monoclonal antibody (M01), clone 2H8. Western Blot analysis of IL20 expression in A-431 ( Cat # L015V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of IL20 expression in transfected 293T cell line by IL20 monoclonal antibody (M01), clone 2H8.Lane 1: IL20 transfected lysate(20.1 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged IL20 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of IL20 transfected lysate using anti-IL20 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with IL20 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol