HPA001075

TAF1 antibody from Atlas Antibodies
BA2R, CCG1, CCGS, DYT3, DYT3/TAF1, KAT4, NSCL2, TAF2A, TAFII250
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001075
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001075, RRID:AB_1080179
Product name
Anti-TAF1
Provider product page
Atlas Antibodies - HPA001075
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SDSDVGSGGIRPKQPRMLQENTRMDMENEESMMSY
EGDGGEASHGLEDSNISYGSYEEPDPKSNTQDTSF
SSIGGYEVSEEEEDEEEEEQRSGPSVLSQVHLSED
EEDSEDFHSIAGDSDLDS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -