HPA001075

TAF1 antibody from Sigma-Aldrich
BA2R, CCG1, CCGS, DYT3, DYT3/TAF1, KAT4, NSCL2, TAF2A, TAFII250
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001075
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001075, RRID:AB_1080179
Product name
Anti-TAF1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001075
Antibody type
Polyclonal
Antigen
Transcription initiation factor TFIID subunit 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SDSDVGSGGIRPKQPRMLQENTRMDMENEESMMSY
EGDGGEASHGLEDSNISYGSYEEPDPKSNTQDTSF
SSIGGYEVSEEEEDEEEEEQRSGPSVLSQVHLSED
EEDSEDFHSIAGDSDLDS
Storage
-20C
Provider Type Product Number
- No reagents -