HPA027344

SERTAD4 antibody from Sigma-Aldrich
DJ667H12.2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027344
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027344, RRID:AB_10601770
Product name
Anti-SERTAD4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027344
Antibody type
Polyclonal
Antigen
SERTA domain containing 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AKLNDEKANDDTNRDGGPLSHEPVGNDLAFECKGQ
FYDYFETGYNERNNVNESWKKSLRKKEASPPSNKL
CCSKGSK
Storage
-20C
Provider Type Product Number
- No reagents -