HPA028016

DTL antibody from MilliporeSigma / Merck KGaA
CDT2, DCAF2, L2DTL, RAMP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028016
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-DTL antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA028016
Antibody type
Polyclonal
Antigen
denticleless homolog (Drosophila) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TVVLFQDENTLVSAGAVDGIIKVWDLRKNYTAYRQ
EPIASKSFLYPGSSTRKLGYSSLILDSTGSTLFAN
CTDDNIYMFNMTGLKTSPVAIF
Storage
-20C